Graph and Spreadsheet results for cytochrome c oxidase subunit 4 isoform 1, mitochondrial isoform 3 precursor [Homo sapiens].: , gi: 5001305723

Accession Number: NP_001305723,   GI Number: 5001305723

Each point on the X axis represents the mean of scale value of each amino acid calculated in the window.


Sequence: KASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYGHLGLCLSDPVIHSL
Window Size: 9     Threshold A: -0.960000     Threshold B: -0.600000     Scale Type: Hopp-Woods
Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPE
Window Size: 9     Threshold A: 0.300000     Threshold B: 0.000000     Scale Type: White
Sequence: RRDHPLPEVAHVKHLSASQKALKEKEKASWSSL
Window Size: 8     Threshold A: -2.100000     Threshold B: -1.700000     Scale Type: Engleman-Steitz
Sequence: SWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYGHLGLCLSDPVIHSL
Window Size: 7     Threshold A: 2.000000     Threshold B: 0.800000     Scale Type: Kyte-Doolittle