Graph and Spreadsheet results for single-pass membrane and coiled-coil domain-containing protein 4 [Homo sapiens].: , gi: 9910226

Accession Number: NP_064564,   GI Number: 9910226

Each point on the X axis represents the mean of scale value of each amino acid calculated in the window.

Sequence: AMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE

Window Size: 9     Threshold A: -0.960000     Threshold B: -0.600000     Scale Type: Hopp-Woods

Sequence: MRQLKGKPKKETSKDKKERKQAMQEARQ

Window Size: 9     Threshold A: 0.300000     Threshold B: 0.000000     Scale Type: White

Sequence: QAMQEARQ

Window Size: 8     Threshold A: -2.100000     Threshold B: -1.700000     Scale Type: Engleman-Steitz

Sequence: QEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE

Window Size: 7     Threshold A: 2.000000     Threshold B: 0.800000     Scale Type: Kyte-Doolittle